SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024482 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024482
Domain Number 1 Region: 82-319
Classification Level Classification E-value
Superfamily Phosphofructokinase 6.28e-77
Family Phosphofructokinase 0.00000368
Further Details:      
 
Domain Number 2 Region: 348-553
Classification Level Classification E-value
Superfamily Phosphofructokinase 9.03e-55
Family Phosphofructokinase 0.0000693
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024482   Gene: ENSSSCG00000011158   Transcript: ENSSSCT00000027374
Sequence length 553
Comment pep:known_by_projection chromosome:Sscrofa10.2:10:73581212:73608329:-1 gene:ENSSSCG00000011158 transcript:ENSSSCT00000027374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCRDERCCPSRRPHGHIRGGQGVLYLRGLPGHGGWRQQHRRGGLGERVQYPASGSQPGWE
ESTSLLLCWVCRKIGRTGVGGGGTIIGSARCKDFRSREGRLKAAANLIQLGITNLCVIGG
DGSLTGANIFRREWSGLLEELAKDGKIDKEAVQRHGHLNVVGMVGSIDNDFCGTDMTIGT
DSALHRIMEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLPESPPEEG
WQEDMCIKLSENRARKKRLNIIIVAEGAIDTQNKPITSEQIKELVVTQLGYDTRVTILGH
VQRGGTPSAFDRILGAERGGSLCWSPGALTPECPSSSPREGGPSAVLLSPDVSVKTQDVQ
KAMDEGRFKEAVKLRGRSFESNLNTYKRLAMKLPDSQIPKTNCNVGVVNVGAPAAGMNAA
VRAAVRVGISDGHKMFAVYDGFEGFAKGNIKEIGWADVGGWTGQGGSILGTKRTLPGKYL
EDIAAQMRAHRINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVSNNVPGSDF
SIGADTALNTITD
Download sequence
Identical sequences ENSSSCP00000024482 ENSSSCP00000011907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]