SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024519 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024519
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000175
Family RecA protein-like (ATPase-domain) 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024519   Gene: ENSSSCG00000023955   Transcript: ENSSSCT00000023145
Sequence length 112
Comment pep:novel chromosome:Sscrofa10.2:12:35497810:35517095:1 gene:ENSSSCG00000023955 transcript:ENSSSCT00000023145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISLANNHRLAVILTNQMTTKIDKNEALLVPALGESWGHAATIRLIFHWDQRQRLATLYK
SPSQKESTVLFQITPQGFRDAVVAPACSLQTEGSLNSRKRSRDSEEEQESKD
Download sequence
Identical sequences ENSSSCP00000024519 ENSSSCP00000024519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]