SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024554 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024554
Domain Number 1 Region: 89-181
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-29
Family Pleckstrin-homology domain (PH domain) 0.00000596
Further Details:      
 
Domain Number 2 Region: 2-69
Classification Level Classification E-value
Superfamily SH2 domain 0.0000133
Family SH2 domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024554   Gene: ENSSSCG00000028367   Transcript: ENSSSCT00000030538
Sequence length 206
Comment pep:novel chromosome:Sscrofa10.2:8:129822230:129850879:-1 gene:ENSSSCG00000028367 transcript:ENSSSCT00000030538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAKDSVKHFHVEYTGYSLKFGFNEFSSVKDFVKHFANQPLIGSETGTLIVLKHPYSRKVE
EPSIYESVRVHTAMQTGRTENDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLQRNELK
YFKDQMSPEPIRILNLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKIL
RWKLSQIRKQLDQGDSTVRSRSFIFK
Download sequence
Identical sequences ENSSSCP00000024554 ENSSSCP00000024554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]