SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024629 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024629
Domain Number 1 Region: 198-327
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 1.18e-53
Family Retrovirus capsid protein, N-terminal core domain 0.00000323
Further Details:      
 
Domain Number 2 Region: 2-98
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 6.47e-40
Family MMLV matrix protein-like 0.00000762
Further Details:      
 
Domain Number 3 Region: 468-511
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000239
Family Retrovirus zinc finger-like domains 0.00081
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000024629
Domain Number - Region: 337-367
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00403
Family Retrovirus capsid protein C-terminal domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024629   Gene: ENSSSCG00000024303   Transcript: ENSSSCT00000025954
Sequence length 519
Comment pep:novel chromosome:Sscrofa10.2:3:18235943:18237502:1 gene:ENSSSCG00000024303 transcript:ENSSSCT00000025954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPPLSLTLDHWTEVKSRAHNLSVQVKKGPWQTFCASEWPTFDVGWPSEGTFNSEIILAVK
AIIFQTGPGSHPDQEPYILTWQDLAEDPPPWVKPWLNKPRKPGPRILALGEKNKHSAEKV
KPSPRIYPEIEEPPTWPEPQPVPPPPYPAQGAARGPSAPPGAPAAEGPAAGTRSRRGATP
ERTDEVVTLLLRTCGPPMPGGQLQPLQYWPFSSADLYNWKTNHPPFSEDPQRLTGLVESL
MFSHQPTWDNCQQLLQTLFTTEERERILLEARKNVPGADGRPTQLQNEIDMGFPLTRPSW
DYNTAEGRESLKIYHQALVAGLRGASRRPTNLAKVREVMQGPNEPPSVFLERLMEAFRRF
TPFDPTSEAQKASVALAFIGQSALDIRRKLQRLEGLQEAELRDLVKEAEKVYYKRETEEE
REQKKEREKEKREERRDRRQEKNLTKILAAVVEGTSSRERERDFRKIRSGPRQSGNLGNR
TPLDKDQCVYCKEKGHWARDCPKKGNKGPKVLALEEDKD
Download sequence
Identical sequences ENSSSCP00000024629 ENSSSCP00000024629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]