SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024632 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000024632
Domain Number - Region: 8-43
Classification Level Classification E-value
Superfamily Globin-like 0.0647
Family Globins 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024632   Gene: ENSSSCG00000027906   Transcript: ENSSSCT00000030745
Sequence length 62
Comment pep:novel chromosome:Sscrofa10.2:1:135829800:135835446:1 gene:ENSSSCG00000027906 transcript:ENSSSCT00000030745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVPQSRKDTFFQVYPDCLTQAIYATFLEAFPESSHLFNDEFKEDLGNNIFLWMSGNDCH
LI
Download sequence
Identical sequences ENSSSCP00000024632 ENSSSCP00000024632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]