SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024670 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000024670
Domain Number - Region: 1-37
Classification Level Classification E-value
Superfamily Translation proteins 0.00385
Family Elongation factors 0.006
Further Details:      
 
Domain Number - Region: 40-87
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0187
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024670   Gene: ENSSSCG00000023123   Transcript: ENSSSCT00000031616
Sequence length 290
Comment pep:novel chromosome:Sscrofa10.2:13:79627804:79634221:1 gene:ENSSSCG00000023123 transcript:ENSSSCT00000031616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQMFHTPVTSAVQGDRLGICVTQFDPKLLERGLVCAPESLHTVHAAVISVEKIPYFRGPL
QTKAKFHITVGHETVMGRVMFFSPAPDSFDHKPVLDSFDFSQEYLFQEQYLCPSSAPAAT
DTTDSGGDDKKAGQASEGHCPRQQWALVEFEKPVTCPRLCLVIGSRLDADIHANTCRLAF
HGVLLHGLEDKNYAESCLPKLRVYKLKHKHGVVERVMDDYSVIGRSLFKKETNIQLFVGL
KGALVHWGAGGSFDSAFGQSGKFKVHIPGECGHFPPPLWEPSRDGGDSAQ
Download sequence
Identical sequences ENSSSCP00000024670 ENSSSCP00000024670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]