SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024689 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024689
Domain Number 1 Region: 26-107
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000006
Family Pyrin domain, PYD 0.035
Further Details:      
 
Domain Number 2 Region: 126-184
Classification Level Classification E-value
Superfamily Caspase-like 0.00000897
Family Caspase catalytic domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024689   Gene: ENSSSCG00000022773   Transcript: ENSSSCT00000026535
Sequence length 185
Comment pep:known chromosome:Sscrofa10.2:13:26306729:26310461:1 gene:ENSSSCG00000022773 transcript:ENSSSCT00000026535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESPGSGRHLERNLWRTPLKLPPLPIRLQETLDQLSPQELRDFRTILKNVDAEPRVKEL
RLELEGGNASGLAQLLAKYYDSEAARRVMVQVLQQLPRADLLPRWRSAAPAVVAAGQVIP
RKMAKRSYDCMEDELDCYDLSGSRKAFLMCVQKNRPGAEQDIQWMEEWLDQCHFERTLCI
DPNKM
Download sequence
Identical sequences ENSSSCP00000024689 ENSSSCP00000024689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]