SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024709 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024709
Domain Number 1 Region: 65-136
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000000000000189
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00026
Further Details:      
 
Domain Number 2 Region: 1-95
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000379
Family Elongation factors 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024709   Gene: ENSSSCG00000030403   Transcript: ENSSSCT00000025530
Sequence length 137
Comment pep:novel chromosome:Sscrofa10.2:13:804554:805017:-1 gene:ENSSSCG00000030403 transcript:ENSSSCT00000025530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETGVLKPGVSVTFAPFVVTTKVKSVAMNHELNKALSGDNVGFTVRKVSEISVAGDSKNDP
LMEATGFTAQVIILNHPEQFSVGYTPVLDYYTAHTVGKFAELKSSDAAIVDTVPGKPIYI
ESSSDSPLGCFAVCDMR
Download sequence
Identical sequences ENSSSCP00000024709 ENSSSCP00000024709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]