SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024812 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024812
Domain Number 1 Region: 373-571
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.11e-69
Family Nuclear receptor ligand-binding domain 0.0000126
Further Details:      
 
Domain Number 2 Region: 95-185
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-29
Family Nuclear receptor 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024812   Gene: ENSSSCG00000027017   Transcript: ENSSSCT00000025072
Sequence length 573
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:12197567:12222739:1 gene:ENSSSCG00000027017 transcript:ENSSSCT00000025072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGGVIAYISSSSSASSPASCHSEGSENSFQSSSSVPSSPNSTNSDNNGNPKSGDLSNIEG
ILKNDRIDCSVKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKG
FFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQ
RMLIEMQSAMKTMMNSQFSGHLQSDALVEHHEQTALPVQEQLRPKPQLEQENIKSSSPPS
SDFAKEEVIGMVTRAHKDTFMYNQEQRENSAETMQPQRERIPQNIEQYNLNHDHCGSGLG
SHFPCSESQQHLNGQYKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVSIDGFSQN
ENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGF
RDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSM
FEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPN
EASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP
Download sequence
Identical sequences ENSSSCP00000024812 ENSSSCP00000024812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]