SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024864 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024864
Domain Number 1 Region: 102-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.22e-17
Family LIM domain 0.0011
Further Details:      
 
Domain Number 2 Region: 145-191
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.76e-16
Family LIM domain 0.00024
Further Details:      
 
Domain Number 3 Region: 37-83
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000119
Family LIM domain 0.00029
Further Details:      
 
Domain Number 4 Region: 9-35
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000277
Family LIM domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024864   Gene: ENSSSCG00000020976   Transcript: ENSSSCT00000026397
Sequence length 193
Comment pep:known_by_projection chromosome:Sscrofa10.2:10:28377349:28398394:1 gene:ENSSSCG00000020976 transcript:ENSSSCT00000026397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNWGGGKRCGVCQKTVYFAEEVQCEGSSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKS
CYGKKYGPKGYGYGQGAGTLSMDKGESLGIKHEETPGHRPTTNPNASKFAQKIGGSERCP
RCSQAVYAAEKVIGAGKSWHKSCFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGF
GFGQGAGALVHSE
Download sequence
Identical sequences I3LL97
ENSSSCP00000024864 XP_003357724.1.46622 ENSSSCP00000024864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]