SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024876 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024876
Domain Number 1 Region: 194-233
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000333
Family Erythroid transcription factor GATA-1 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024876   Gene: ENSSSCG00000025754   Transcript: ENSSSCT00000030760
Sequence length 266
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:69455652:69458749:-1 gene:ENSSSCG00000025754 transcript:ENSSSCT00000030760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPQVGLIGNPCPERTKDPRMLQTQWQALLCGPGKGVTTLPLAPRSFWSAHQDSVTALHF
LQETAEGLAQPPAWDTQAQGPCWEPKALRTPGPLPLAKDAKNMLSHSPGPPEAPPASSAQ
PQRKPRKQPNPQRGAEKVDPLFEGVTLKFQIKPDCSLQIIPSYSLACSSRSQGPMTGPAR
GPEANPGGSEALGPRRCASCRTQRTPLWRDAEDGTPLCNACGIRYKKYGTRCSSCWLVPR
KNVQPKRLCGRCGVSLGPHPVPTQEG
Download sequence
Identical sequences 9823.ENSSSCP00000014506 ENSSSCP00000024876 ENSSSCP00000024876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]