SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025042 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025042
Domain Number 1 Region: 386-696
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 9.06e-42
Family Rhodopsin-like 0.00061
Further Details:      
 
Domain Number 2 Region: 88-370
Classification Level Classification E-value
Superfamily L domain-like 1.56e-34
Family Ngr ectodomain-like 0.029
Further Details:      
 
Domain Number 3 Region: 18-56
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025042   Gene: ENSSSCG00000022213   Transcript: ENSSSCT00000024513
Sequence length 729
Comment pep:known scaffold:Sscrofa10.2:JH118973.1:36361:66662:-1 gene:ENSSSCG00000022213 transcript:ENSSSCT00000024513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FYLLFHIDFARTEGSSITSLCPKGYFPCGNLTQCLPRAFHCDGVDDCGNGADEENCGDTS
GWATIFGTVHGNANNVALTQECFLNQYPQRCYCKETELDCINAGLTSVPTVSSNVTLLSL
KKNNIHSLSDKVFIKYTELKKIEIQHRSKKICSPHAFTPDHLQLQWHQMHLLTQHYPDIL
KQLRSSATPILDDNPITRISQRLFAGLNSLFFLSMVNNYLEALPRQMCANMPHLNWLDLE
GNGIKHLTNSTFLSCGSLTVLFLPRNQIDIVPEKTFSSLKNLGELDLSSNLIMELPPHIF
KDLKLLQKLNLSSNPLLYLHKNQFESLKQLQSLDLERIEIASISTRMFQPMKNLSHIYFK
NFRYCSYAPHVRICMPLTDGISSFEDLLANNILRIFVWVIAFITCFGNLFVIGMRSFIKA
ENTTHATSIKTLCCADCLMGVYLFFIGFFDLKYRGQYQKYALLWMESLQCRLLGFLAMLS
TEVSVLLLTYLTLEKFLAVVFPFSNIRPGKWQTSGILIGIWIVGFLIAAIPFWKEDYFGN
FYGKNGVCFPLYYDQTEAIGSKGYSLGIFLGVNLLAFLIIVFAYTIMFCSIQKTALQTSE
VRSPTGREVAVANRFFFIVFSDAICWIPVFVIKILSLFRVEIPGSLTSWVVIFFLPVNSA
LNPILYTLTTSFFKDTLKQLLHNQRRKSIFKTKKKSLSTSIVWTDDSSSLKLGVLNKIPL
GDNIVKPLS
Download sequence
Identical sequences ENSSSCP00000025042 ENSSSCP00000025042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]