SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025205 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025205
Domain Number 1 Region: 270-372
Classification Level Classification E-value
Superfamily BRCT domain 4.07e-22
Family BRCT domain 0.029
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000025205
Domain Number - Region: 409-492
Classification Level Classification E-value
Superfamily BRCT domain 0.00137
Family DNA ligase 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025205   Gene: ENSSSCG00000021966   Transcript: ENSSSCT00000026732
Sequence length 526
Comment pep:novel chromosome:Sscrofa10.2:13:82202790:82230490:1 gene:ENSSSCG00000021966 transcript:ENSSSCT00000026732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLDISAVQDGRLCNNRLLSADSTAMDDEADHLPIEENDIDSMTTGNKESATANGNGRND
SKGALTQTLEMRENFQKQLQEIMSATSIVKPQGQRNSLSRSGCNSASSTPDSTRSARSGR
SRVLEALRQSRQTVPDINTEPSQNEQIIWDDPTAREERARLASNLQWPSCPTQYSELQVD
VKKLEDSPFQEPLHDSEIAAQAVCDPGNICVTEAPKHPVSEEVETPIKDSHLIPTPQAPS
IAFPLANPPVAPHPREKVITIEETHEDLKKQYIFQLSSLNPQERIDYCHLIEKLGGLVIE
KQCFDPNCTHIVVGHPLRNEKYLASVAAGKWVLHRSYLEACRTAGRFVPEEDYEWGSSSI
LDVLTGISVQQRKLALAAMRWRKKIQQRQESGIVEGAFSGWKAILHVDQSREAGFKRLLQ
SGGAKVLPGRSVSLFKEATHLFSDFNKLKPDDSGVNIAEAAAQNVYCLKTEYIADYLMQE
SPPPVENYCLPEAVSFLPNNKEPGPGFSQKRKAPTEKNKIKRPRVQ
Download sequence
Identical sequences ENSSSCP00000025205 ENSSSCP00000025205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]