SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025435 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000025435
Domain Number - Region: 42-74
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0741
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025435   Gene: ENSSSCG00000020737   Transcript: ENSSSCT00000022381
Sequence length 199
Comment pep:novel chromosome:Sscrofa10.2:2:5904731:5907469:-1 gene:ENSSSCG00000020737 transcript:ENSSSCT00000022381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNGAEVDDFSWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGETCADCGTIL
LQDKQRKIYCVACQELDSDVDKDNPALNAQAALSQAREHQLASASEPPLGSRPAPQPPVP
RPEHCEGAAAGLKAVQGPPPPAVPPNAEVVACTREALLQKLAWASAELGSSTSLETSIQL
CSLIRACAEALRSLQQLQP
Download sequence
Identical sequences F1RRI4
ENSSSCP00000025435 XP_020938511.1.46622 9823.ENSSSCP00000013814 ENSSSCP00000025435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]