SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025458 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025458
Domain Number 1 Region: 205-330
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 1.1e-39
Family Retrovirus capsid protein, N-terminal core domain 0.0000438
Further Details:      
 
Domain Number 2 Region: 4-100
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 8.83e-28
Family MMLV matrix protein-like 0.00061
Further Details:      
 
Domain Number 3 Region: 453-491
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000759
Family Retrovirus zinc finger-like domains 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025458   Gene: ENSSSCG00000024833   Transcript: ENSSSCT00000024715
Sequence length 495
Comment pep:known chromosome:Sscrofa10.2:6:53565252:53566786:-1 gene:ENSSSCG00000024833 transcript:ENSSSCT00000024715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKSASKPTVLECMVKNFKKGFSRDYGVKLSPGKLCTLCTLEWPYFGVGWPPEGTLDVFT
VTAVYNVITGDPGHPDQFPYIDQWLEIAYLRPPWVRFCTTDQGQCRVLVAQSKKKNLSQK
KVPPIYQGEPDDSPPMPPPNVLLAPPPGAKGPQMPDSPPPSVSPPPLLLKLPRRYHPGAA
TPALQMPLRETRGPQQVAPDGTIQEGGRFYYYQPFSTADLLNWKHHTPSYSEKPQALINL
LEFIFQTHCPTWIDCRQLLFTLFDTEEHWRIVAEAQKWLQANAGGRADLANWVREAFPEE
NPHWDYDTEEGKRNLERYRQAFLQGAKAGAKKPTNIAKIREILQEPNESPAKFYERLCEA
FRTYTPFDPKAPENQRMINAAFVGQAQSDIHKKLQKLEGFAGENATKLLEIAHKVFINRD
QVARCDAEKRMKQKVTLLAAALSKPVPPVGPPRRGQGTRPGKMSPLEHDQCAYCKEKGHW
KNECPNCPEKKTKAP
Download sequence
Identical sequences ENSSSCP00000025458 ENSSSCP00000025458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]