SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025599 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025599
Domain Number 1 Region: 108-170
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.31e-19
Family LIM domain 0.0069
Further Details:      
 
Domain Number 2 Region: 167-229
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.15e-19
Family LIM domain 0.00077
Further Details:      
 
Domain Number 3 Region: 226-288
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.26e-16
Family LIM domain 0.0013
Further Details:      
 
Domain Number 4 Region: 81-112
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000348
Family LIM domain 0.013
Further Details:      
 
Domain Number 5 Region: 285-314
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000976
Family LIM domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025599   Gene: ENSSSCG00000021176   Transcript: ENSSSCT00000031344
Sequence length 316
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:12191484:12243400:1 gene:ENSSSCG00000021176 transcript:ENSSSCT00000031344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCSEVQEPKESPPPPKTSAAAQLDELMAHLCEMQIQGTVKVDASTKHLPEKQDPKTSLDS
MLGGLEQELQDLGIATVPKGHCASCQKPIAGKMIHALGQAWHPEHFVCAHCKEEIGSSPF
FERTGLAYCSKDYHHLFSPRCAYCAAPILDKVLTAMDQTWHPEHFFCAHCGEVFGAEGFH
EKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCFSSFSTGSFFE
LDGRPFCELHYHQRRGTLCHGCGQPITGRCISAMGYKFHPEHFVCDFCLMQLSKGIFREQ
NDKTYCQPCFNKLFTQ
Download sequence
Identical sequences ENSSSCP00000025599 ENSSSCP00000025599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]