SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025604 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025604
Domain Number 1 Region: 76-174
Classification Level Classification E-value
Superfamily DEATH domain 1.37e-21
Family Caspase recruitment domain, CARD 0.012
Further Details:      
 
Domain Number 2 Region: 367-449
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000785
Family Tropomyosin 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025604   Gene: ENSSSCG00000025260   Transcript: ENSSSCT00000030648
Sequence length 450
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:7898524:7966380:1 gene:ENSSSCG00000025260 transcript:ENSSSCT00000030648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGPGSPGGHGAGGGAGGAADPAPLRRRSRRPSADPGVRGGGGVRDPEDAAMPGGAEAG
ETEEEAGGGSGSEAEEDALWERIEGVRHRLTRALNPAKLTPYLRQCRVIDEQDEEEVLST
YRFPCRVNRTGRLMDILRCRGKRGYEAFLEALEFYYPEHFTLLTGQEPAQRCSMILDEEG
PEGLTQFLMTEVRRLREARKSQLQREQQLQARGRALEEERAGLEQRLREQQQAQERCQRL
REDWEAGSLELLRLKDENYMIAMRLAQLSEEKNSAVLRSRDLQLAVDQLKLKVSRLEEEC
LLLRRARGPLPGAEEKEKEPDSTDLVSELRAENQRLAASLQELQEGLQQEVSRPGAPASE
RILLDILEHDWREAQDSRQELCQKLHAVQGELQWAEELRDKYLQEMEDLGLKHRTLQKDC
DLYKHRMATVLAQLEEIEKERDQVSRACGV
Download sequence
Identical sequences ENSSSCP00000025604 ENSSSCP00000025604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]