SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025662 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025662
Domain Number 1 Region: 50-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.66e-34
Family SCAN domain 0.00013
Further Details:      
 
Domain Number 2 Region: 222-283
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-21
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 766-818
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.67e-18
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 834-886
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.24e-16
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 972-1024
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.52e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 481-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000127
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 591-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000867
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 8 Region: 674-723
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000208
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 9 Region: 517-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000163
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 10 Region: 873-926
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000028
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025662   Gene: ENSSSCG00000024556   Transcript: ENSSSCT00000031378
Sequence length 1027
Comment pep:novel chromosome:Sscrofa10.2:13:30608378:30617562:1 gene:ENSSSCG00000024556 transcript:ENSSSCT00000031378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGRWYAVHPAQAKASRERGRLQMVKKEEEDEDYTSVPATRPQTLNRPGQELFRQLFRQ
LRYHESSGPLETLSRLRELCRWWLRPDVLSKAQILELLVLEQFLSILPGELRTWVQLHHP
ESGGEAVALLEELQRDFDGSPWRDPAPAQSPDVHWMGTGALQATQIWPPASPLRSGSALG
DHLQPPCEIGVRDFLAGQPDSPAAQVPTLSQREGCPGDQVTAQPQEALTFKDVEVTFSQD
EWGWLDASQRNLYRDVMLENYGNIASLMGPFTKPALISWLETREPWVLNVQGAQPEGNPG
ADVAGGELHMKTKKFNLKHEPLKEAVTLAIPSGCHGSANISKETGLREPSEQKSRLKEPC
GNPVQVKVEKEETDSSHGTGKDCEDSGRSNSLHLKHTMYLRGPRRKQSLKHGCGRHFRGS
SYHCEYKEYGKGLRCLLGGFSLHQRIHAGLKGKPKDAHGKDFSLSSHHQHAQNRHVVGMS
YKCGDCGRTFSHSSHLTCHQRLHTQEKPFKCRACGKAFRWSSNRARHEKIHTGLKPYKCN
LCDKAFRRMSAYRLHQETHAKQKCLESNQYEEALSCGSEFERHLGDQTGEKLFDCSQCRK
SFHCKSYILEHQRIHTQEKPYKCTKCRKTFRWRSNFTRHMRLHQEETFYDQDECREDFRQ
TPNDSQPQRAPTVENSFSCQQCGKTFTQKKSLIDHQRSHSGEKSYWCSECAKEFTHRSTF
VVHKKQHTFKREPEDAPPLSQDRAFQVPQSSHTTEEPCTCSQCGRAFRNHSILLIHQRVH
TREKPYKCMECGKSFRWSSNLSQHQRVHSLEKPYMYREREDPPNLQSQILTGEKPFWCQE
CGKTFTRKRSLIDHKGIHSGEKRYKCNLCGKSYDRNHRLVNHQRIHTKERPFKCQWCGKD
FIGRHTLCVHQRKHTSVAQSECSVAGLSSRQDSRVSLQELKPREEKPLEDCKEACDQRSG
LTGLEDVPIGGKCHKCSTCGKTFNKSSQLISHKRFHTRERPFKCRECGKTFRWSSNLARH
MKSHVRD
Download sequence
Identical sequences A0A287BPX9
ENSSSCP00000025662 XP_003358435.1.46622 XP_005657124.1.46622 XP_020927384.1.46622 XP_020927385.1.46622 ENSSSCP00000025662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]