SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025730 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025730
Domain Number 1 Region: 558-907
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.53e-110
Family PDEase 0.00000226
Further Details:      
 
Domain Number 2 Region: 371-553
Classification Level Classification E-value
Superfamily GAF domain-like 5.45e-49
Family GAF domain 0.0000000626
Further Details:      
 
Domain Number 3 Region: 201-384
Classification Level Classification E-value
Superfamily GAF domain-like 1.77e-35
Family GAF domain 0.0000000173
Further Details:      
 
Domain Number 4 Region: 22-173
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000105
Family GAF domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025730   Gene: ENSSSCG00000029388   Transcript: ENSSSCT00000031538
Sequence length 918
Comment pep:known chromosome:Sscrofa10.2:9:7896906:7928538:-1 gene:ENSSSCG00000029388 transcript:ENSSSCT00000031538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAPWAGGLPGLVGQRPSPPFPLFQDALLNLGSVLDVAGLQRAVKEALSAVLPRVETVYTY
LRDRESRLVCEEPCHELPQEGKVREAVISRKRVGCNGLSPSDLQGRPLARLVAPLAPDTQ
VLVIPLVDEEAGALAAVVLVHCGQLSDSDEWSLQAVEKHTLVALKRVQALQQRGPGAAPE
AAQKPPEGVAGDQKGGVGYTDQDRKILQLCGELYDLDASSLQLKVLQYLQQETQASRCCL
LLVSEDNLQLSCKVIGDKVLQEETSFPLTTGRLGQVVEDKKSIQLQDLTSEDVQQLQSML
GCELQAMLCVPVISRATDQVVALACAFNKLGGDLFTDQDEHVIQHCFHYTSTVLTSTLAF
QKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQNELVAK
VFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNIL
CFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYR
SHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDTNFASFTYTPRSLPEDDTSMAILSML
QDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLED
IEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGC
NIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRTNKQHHSLLLCLL
MTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFM
EHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYEMH
ELGSARAPVNGCCSLDAE
Download sequence
Identical sequences ENSSSCP00000025730 ENSSSCP00000025730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]