SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025743 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000025743
Domain Number - Region: 45-77
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0706
Family Toll/Interleukin receptor TIR domain 0.01
Further Details:      
 
Domain Number - Region: 70-156
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.0828
Family Transforming growth factor (TGF)-beta 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025743   Gene: ENSSSCG00000023289   Transcript: ENSSSCT00000031842
Sequence length 166
Comment pep:known_by_projection chromosome:Sscrofa10.2:10:14103401:14103898:-1 gene:ENSSSCG00000023289 transcript:ENSSSCT00000031842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFWKLSVSLLLMAALEKVEDAQRARPAGSIPSPRKDGSPESTGRWQLIKEVLASSQEALV
VTERRYLRSDWCKTQPLRQTVHEEGCHSRTVLNRFCYGQCNSFFIPRPGGGSWGSFQSCA
FCRPQRAAALLVELQCPGRDPPFHLRKIQKVKQCKCMSVTLGSDEP
Download sequence
Identical sequences F1S9G0
ENSSSCP00000025743 ENSSSCP00000025743 XP_005653823.1.46622 9823.ENSSSCP00000011559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]