SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025775 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025775
Domain Number 1 Region: 203-320
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 1.18e-27
Family Retrovirus capsid protein, N-terminal core domain 0.00011
Further Details:      
 
Domain Number 2 Region: 8-100
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 1e-24
Family MMLV matrix protein-like 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025775   Gene: ENSSSCG00000026997   Transcript: ENSSSCT00000025947
Sequence length 383
Comment pep:novel chromosome:Sscrofa10.2:1:158381573:158382789:-1 gene:ENSSSCG00000026997 transcript:ENSSSCT00000025947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGKLASKPTVLECMVKNFKKGFSRDYGVKLSPGKLGTLCTLEWPTFGVGWPPEGILDVFM
VGAVYNVITGDPGHPYQFPYIDQWLEIAHLRPPWIRFCATGQEQCKVLVFHSKKKTLSQE
KVPHIFQGETEASPSMPPPYVLSAPPLRAEDSPPSVPPTPAPEVPEAISPPQPDSPEPMS
SIANALQETWGPRQITPDGTIEERGWFFCYHPFSTADLLNWKHHTHSYSEKPQALNLIEF
IFQTHCSTWIDCRQLLFTLTLKSTEAHKCLEANAGGRAELENWVREAFPEENPHWDYDTE
EGKCNLERYWQAFLQGAKAGDKRPTSIAKTSELLQELNESPAKFYERLCEAFQIYTPFDP
QAPKNQWMINAAFVGQSQSDIHK
Download sequence
Identical sequences ENSSSCP00000025775 ENSSSCP00000025775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]