SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025922 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025922
Domain Number 1 Region: 151-339
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.00000209
Family Glycerol-3-phosphate (1)-acyltransferase 0.013
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000025922
Domain Number - Region: 756-795
Classification Level Classification E-value
Superfamily Ribosomal protein S18 0.0301
Family Ribosomal protein S18 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025922   Gene: ENSSSCG00000008121   Transcript: ENSSSCT00000032292
Sequence length 800
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:48487404:48497055:-1 gene:ENSSSCG00000008121 transcript:ENSSSCT00000032292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTMSEARLQTQQRSSRNGRETSLWSSGFGMKLEAVTPFLGKYRPFVGRCCQTCTPKSWE
SLFHRSIMDLGFCNVILVKEENTRFRGWLVRRLCYFLWSLEQHIPLCQDAPQKIMESTGV
QNIISGRAPGGAGEGQGPSLVKKEVQRILGHIQTPPRPFLLRLFSWALLRFLNCLFLNVQ
LHKGQMKMVHKAAQAGSPLVLLSTHKSLLDGILLPFVLLSQGLGVLRVAWDPRIFSPILR
ALLKKLGGLFLPPEANLSPDSSEGFLARAVFHEAVQQLLVSGQPLLIFLEEPPGAQGPRL
SALGQTWLGLVVQAVRVGTVPDAMLVPVAITYDLVPDAPRDTYQALAPLGLWTGALAALR
SLRGWGRGRRVCARVHLAQPFSLQEYTINARSCWDSRQTLEQLLQPIVLGQCTVVPDTEK
EQEWTPVTGPLLALKEEDQLLVRRLSRHILNASVASSAVMSTAIMATLLLFRHRKGVFLS
QLLGEFSWLTEETLLRGFDVGFSGQLRCLVQHTLSLLRAHVALLRVHQGDLLVVPRPGPG
LVHLARLSAELLPAFLSEAVGACAVRGLLAGRVPPEGPWELQGIELLSQNDLYRQILLLL
HLLPRDLLLLQPCQSSYCYCQEVLDRLIQCGLLVAEETPGSRPACDTRRQRLSAKLLWKP
SGDFTDSDSDNFEEAEGRYFRLSQQSRCPDFFLFLCRLLSPLLKAFAQAATFLRQGQLPD
TESGYVEQLFQFLQATAQEEGFFECADPNLAISAVWTFRDLGVLQQMPSPAGPMLHLSPT
FASWDNQEKLEQFIQQFICG
Download sequence
Identical sequences ENSSSCP00000008671 ENSSSCP00000025922 XP_013851296.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]