SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025982 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025982
Domain Number 1 Region: 96-262
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.14e-22
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 2 Region: 4-78
Classification Level Classification E-value
Superfamily F-box domain 3.27e-18
Family F-box domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025982   Gene: ENSSSCG00000025765   Transcript: ENSSSCT00000031471
Sequence length 269
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:29513799:29539561:1 gene:ENSSSCG00000025765 transcript:ENSSSCT00000031471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METESAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKYWLI
SEEEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKEGAR
EEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGG
FQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFIIGA
TFTDWFTSYVNNVVSGGFPIIRDQIFRYV
Download sequence
Identical sequences ENSSSCP00000025982 ENSSSCP00000025982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]