SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026086 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026086
Domain Number 1 Region: 9-151
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 1.96e-55
Family TRADD, N-terminal domain 0.000000575
Further Details:      
 
Domain Number 2 Region: 192-279
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000016
Family DEATH domain, DD 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026086   Gene: ENSSSCG00000024182   Transcript: ENSSSCT00000027163
Sequence length 283
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL896501.1:3469:6207:1 gene:ENSSSCG00000024182 transcript:ENSSSCT00000027163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XAAGPNGLEEWVGSAYLFVESSLDKVVLSESYAHQQHKAAVYRALRTALAESGGSPEELQ
MLKIHRSDPQLIVQLRFCGRQACSRFQACLEAALALSSVPLQLELRASAERLDALLTDEE
RCLNFIFAQKPDRLRDEELTELEDALRNLTCGSGGQGGDVEGAPATSTXGQTFLFQGQPV
VNRPLSLQDQLTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLL
RRFVQAEGRRATLQRLVEALEENELTSLAEGLLGLANPDGSLA
Download sequence
Identical sequences ENSSSCP00000026086 ENSSSCP00000026086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]