SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026230 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026230
Domain Number 1 Region: 14-48
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026230   Gene: ENSSSCG00000027417   Transcript: ENSSSCT00000032434
Sequence length 287
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:89712706:89832876:-1 gene:ENSSSCG00000027417 transcript:ENSSSCT00000032434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEAGLQATSAVTECTFTCTSGQCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFS
SELELAQVLVVVVVVTVMVVVIVCLLHRYRVSSRSFIQRQRPEAGLQPEGRLWPLDGSGP
RPASELMFGPRFRDGVPGPAFLQRERDRFGGFQPTYPFVQRDIDLPPTISLSDGEEPPPY
QGPCALQLRDPEQQLELNRESVRAPPNRTIFDSDGLASVRSGGPCPPSSHSGISASTCSS
HGRMEGPPPPYSEAMGCPRGSAPVPPRAPGSMVPPAQGKDRKAGDLA
Download sequence
Identical sequences I3LQ52
ENSSSCP00000026230 XP_005665319.1.46622 XP_005665320.1.46622 XP_013854661.1.46622 XP_013854662.1.46622 XP_013854664.1.46622 XP_013854665.1.46622 XP_013854666.1.46622 XP_020951675.1.46622 XP_020951676.1.46622 ENSSSCP00000026230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]