SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026476 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026476
Domain Number 1 Region: 64-136
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.92e-24
Family SCAN domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026476   Gene: ENSSSCG00000030015   Transcript: ENSSSCT00000031675
Sequence length 142
Comment pep:known chromosome:Sscrofa10.2:6:74034220:74039692:1 gene:ENSSSCG00000030015 transcript:ENSSSCT00000031675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMEGDPEMQRNGEIQNDDISALPNEMLAEEPEVVLIAPPQVQVPPESFKDSEEDLETVP
RGRPLTPAASRQRFRKFRYEDAAGPRDVLRQLQELAGQWLRPDIHTKEQIVEMLVQEQLQ
AVLPEELRARAQRCQPGVRITG
Download sequence
Identical sequences I3LQU4
ENSSSCP00000026476 NP_001230507.1.46622 ENSSSCP00000026476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]