SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026494 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026494
Domain Number 1 Region: 130-226
Classification Level Classification E-value
Superfamily Immunoglobulin 7.24e-18
Family I set domains 0.00088
Further Details:      
 
Domain Number 2 Region: 37-112
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000126
Family V set domains (antibody variable domain-like) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026494   Gene: ENSSSCG00000026252   Transcript: ENSSSCT00000029574
Sequence length 298
Comment pep:known_by_projection scaffold:Sscrofa10.2:JH118804.1:15476:42433:-1 gene:ENSSSCG00000026252 transcript:ENSSSCT00000029574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISYFDALKLMCYELREAVIKLSDHKACGFSDPKDHHVVTAIEYQEVILACKYPKKTVSSR
LEWKKLGRGISFVYYQQALQGAFKDRAELIDFSIRIKNVTRNDAGKYRCEISAPSEQGQN
LAEDTVTLEVLVAPAVPSCEVPSSALSGTTVELRCQDKEGNPAPEYTWFKDGIRLSGNPR
LDAQSTNSSYTMNVKSGSLQFNAVSKLDSGEYSCEARNSVGHRKCPGKRMQVGKHEILGE
PNGLHLKSLIICVCGVYVCFHVEKGWHCQASTNRKSGSASKAPTMSENDFKHTKSFII
Download sequence
Identical sequences ENSSSCP00000026494 ENSSSCP00000026494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]