SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026533 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026533
Domain Number 1 Region: 46-136
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.7e-39
Family SCAN domain 0.0000625
Further Details:      
 
Domain Number 2 Region: 273-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.73e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 243-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-18
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026533   Gene: ENSSSCG00000030018   Transcript: ENSSSCT00000025323
Sequence length 336
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:111645960:111651941:-1 gene:ENSSSCG00000030018 transcript:ENSSSCT00000025323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAKLRDSSKLLLQTSEDPDCILVTKMEERGQAHNMVSSRHWSSYYSSETYRQRFRQFDY
QESPGPREALSRLRELCCQWLRPEVHSKEQILELLVLEQFLAMLPAELQTWFQENRPGSG
EEAVVMLEELEKEHDGAAKQICLGQKEDLLAKTLPAYEITPETPQSQLKPMKQPLWASKK
LQSLRQNDKDSKTVNVKSRQNTSSGTELYYRVSNSPQMNASQSFTFRGTCEQDRNFERRQ
GNHPRKKQHKCGECGKVFSQSSALNLHQRIHSGEKPYTCDVCAKAFSRSAILIQHRRIHT
GEKPFKCHECGKAFSQSSNLLRHRKKHSGEKVPSVL
Download sequence
Identical sequences I3LR01
XP_005665405.1.46622 XP_013854751.1.46622 XP_013854752.1.46622 XP_020951926.1.46622 XP_020951927.1.46622 ENSSSCP00000026533 ENSSSCP00000026533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]