SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026687 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026687
Domain Number 1 Region: 189-294
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000144
Family Spermadhesin, CUB domain 0.0037
Further Details:      
 
Domain Number 2 Region: 137-174
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000511
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 31-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000824
Family Spermadhesin, CUB domain 0.0039
Further Details:      
 
Domain Number 4 Region: 319-344
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000668
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 5 Region: 389-419
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000969
Family LDL receptor-like module 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000026687
Domain Number - Region: 346-388
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00367
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026687   Gene: ENSSSCG00000023053   Transcript: ENSSSCT00000023641
Sequence length 691
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL896267.1:46047:50431:-1 gene:ENSSSCG00000023053 transcript:ENSSSCT00000023641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLPFLALPLGGALAHQDRILFPNHACEDPPAVLLEVQGTIQRPLGRDSRISPANCTWLIL
GSKEQTVTIRFQKLHLACGSERLILSSPFQPQLSLCEAPASPLQLPGGNVTITYSYAGAR
APMGQGFLLSYSQDWLMCLQEEFQCLNHRCVPLAQRCDGFDACGDGSDEAGCSSDPFPEL
TPVPVPTPPCNHTLEDFYGVFSSLGYSHLASVSHPQSCLWLLDPHDGRRLAVRFTALDLG
YGDAVHVYDGTXLRSLTHFSNGKAVTVETLSGQATVDCHTVAWSSGRGFNATYHVRGYCL
PWDRPCGLGSGLGASEGLGERCYSEAQRCDGSWDCADGTDEENCPSCPPGHYPCGAAGTP
GATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKXDGQPDCADGSDEWDCSYA
LPRKVITAAVIGSLVCGLLLVIALGCTTVTEWGLRERKDLCSYRRPEGAHATYGLAPGVV
QLGGKGAPLREGPVLDPERRRGTLDDLGKPCHSSRCPGLGVEVKSPSWLGRLLCRRLPPM
GSSLPRVSQPSPPPDSVAELSAGQPALSAADLAPGHDSEGGAVGGQDGEQAPPLPVKAPL
PPASTSAAFPTVSEAPGPLPSASLEPSLLSGVVQALRGRLLPSLRPPGPTRDPPGPHTTV
LSPEDEDDVLLVPLAEPGVWVVEAEDEPLLA
Download sequence
Identical sequences ENSSSCP00000026687 ENSSSCP00000026687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]