SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026759 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026759
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-23
Family PDZ domain 0.0000175
Further Details:      
 
Domain Number 2 Region: 232-261
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000128
Family LIM domain 0.00075
Further Details:      
 
Domain Number 3 Region: 200-231
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000856
Family LIM domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026759   Gene: ENSSSCG00000015796   Transcript: ENSSSCT00000026298
Sequence length 277
Comment pep:known chromosome:Sscrofa10.2:15:53297822:53328139:-1 gene:ENSSSCG00000015796 transcript:ENSSSCT00000026298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQNVILPGPAPWGFRLSGGIDFNQPLIITRITPGSKAAAANLCPGDVILAIDGYGTESM
THADAQDRIKAAAHQLCLKIDRAETRLWSPQVTEDGKAHPFKINLESEPQDVNYFEHKHN
IRPKPFIIPGRSSEPTTASVPPQSDVYRMLHDNRNEPTQPRQSGSFRVLQELVNDGPDDR
PAGTRSVRAPVTKIHGGAGGTQKMPLCDKCGSGIVGAVVKARDKYRHPECFVCADCNLNL
KQKGYFFVEGELYCETHARARMRPPEGYDTVTLYPKA
Download sequence
Identical sequences D3GGC9
ENSSSCP00000026759 XP_005671774.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]