SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026861 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026861
Domain Number 1 Region: 93-240
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.01e-34
Family Ankyrin repeat 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026861   Gene: ENSSSCG00000027971   Transcript: ENSSSCT00000023385
Sequence length 259
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL896398.1:5549:11599:-1 gene:ENSSSCG00000027971 transcript:ENSSSCT00000023385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTHPAEDLSLTQQASTPEFGDPEDPRDEAPDSSDTVVLSLFPCTPEPGIAEPDAGTSS
PQGSSLKHSTTLTNRQRGNEVSALPATLDSLSIHQLAAQGELSQLKEHLXPGDNLINKPD
ERGFTPLIWASAFGEIETVRFLLEWGADPHILAKERESALSLASTGGYTDIVGLLLERDV
DINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQV
IENHILKLFQSNLVPADAE
Download sequence
Identical sequences ENSSSCP00000026861 ENSSSCP00000026861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]