SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026919 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026919
Domain Number 1 Region: 36-76
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000156
Family LIM domain 0.00027
Further Details:      
 
Domain Number 2 Region: 2-35
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000306
Family LIM domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026919   Gene: ENSSSCG00000022766   Transcript: ENSSSCT00000024008
Sequence length 379
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:16489077:16493022:-1 gene:ENSSSCG00000022766 transcript:ENSSSCT00000024008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFQAPARETCVECQKTVYPMERLLANQQVFHISCFRCSYCNNKLSLGTYASLHGRIYCKP
HFNQLFKSKGNYDEGFGHRPHKDLWASKLENEETLERPAQLPNAAEIPQSPGVEDAPIAK
VGVLTASMEAKASSQLEKEDKPAETKKLRIAWPPPTELSSGVLLEEGIKVSKPKWPPEDE
VSKPEAPEDVDLDLKKLRRSSSLKERSRPFTVAASFRTASVKSPKPLSPPMRKGWSLSEQ
SEEFGGDVAAERKQMEKASASEKNGSVGKTTWPSKESRGGEAAGRSKEVQDFEIGSENLI
ENGASLDEGDRDLLQQQSPLEPKSKNWSSFADNTSAKEFTTQKQKSQDVEFWEGEVVEEL
SVEEQIKRNRYYDEEEDEE
Download sequence
Identical sequences ENSSSCP00000026919 ENSSSCP00000026919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]