SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026948 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026948
Domain Number 1 Region: 167-289
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 9.42e-38
Family Retrovirus capsid protein, N-terminal core domain 0.0000395
Further Details:      
 
Domain Number 2 Region: 1-63
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 1.41e-18
Family MMLV matrix protein-like 0.00084
Further Details:      
 
Domain Number 3 Region: 406-441
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000733
Family Retrovirus zinc finger-like domains 0.001
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000026948
Domain Number - Region: 298-357
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0125
Family Retrovirus capsid protein C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026948   Gene: ENSSSCG00000023152   Transcript: ENSSSCT00000024233
Sequence length 443
Comment pep:novel chromosome:Sscrofa10.2:X:53415578:53416953:-1 gene:ENSSSCG00000023152 transcript:ENSSSCT00000024233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLCTLEWPSFGVGWPPEGTLDVFTVTAVYNVITGDPGHPDQFPYIDQWLEIAYLRPPWVW
LCTTDQGQCRVLVAQSKKKTLSQKKVPPIYQGEPDDSPPMPPPYVLPAPPPGAKGPQMPD
SPPPSVSPPPSASEVPEAISPPQPDSPEPMSRCLWSAQGAATPALQMPLRYQPFSTADLL
NWKHHTPSYSEKPQALTDLLEFIFQTHRPTWIDCRQLLFTLFETEARWQIITEAPKWLQA
NAGGPADLANWVREAFLEEHPHWDYDTEEGKHNLERYRQAFLQGAKAGAKRPTNIAKISE
ILQEPNESPAKFYERLCEAFRTYTPFDPEAPENQQMINAAFVGQAQSDTRKKLQKLKGFA
GENATKLLEIAHKVFINRDQVARRDAEKRMKQTALSKPVPPVGPPRRGQGTRPGKRSPLE
HDQCAYCKEKGHWKNECPNRPEK
Download sequence
Identical sequences ENSSSCP00000026948 ENSSSCP00000026948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]