SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027214 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027214
Domain Number 1 Region: 38-128
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.29e-29
Family SCAN domain 0.0000696
Further Details:      
 
Domain Number 2 Region: 614-671
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.64e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 558-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.63e-20
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 727-778
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-17
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 520-572
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-17
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 6 Region: 671-737
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 7 Region: 383-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-16
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 8 Region: 346-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000168
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 9 Region: 477-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000912
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000027214
Domain Number - Region: 431-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.021
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027214   Gene: ENSSSCG00000029641   Transcript: ENSSSCT00000025347
Sequence length 784
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:40581662:40587506:-1 gene:ENSSSCG00000029641 transcript:ENSSSCT00000025347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAEPGPAAREPEQLGAVKLEEEEAAGLEDPRQPEARPRPEVAHQLFRCFQYQEDMGPRA
SLSRLRELCNHWLRPALHTKKQILELLVLEQFLSVLPPHLLARLQGQPLRDGEEVVLLLE
GVHRESGNVGPLDFSFNAGKNCPRADITLEEQGGSSHVSSHSPKKEVHSEGPPALEPPKE
HPPCQPGPSMFADMGAWRHPSRSKLPLSPGPKRTLQALQESAPQGPEPWPEESSGDQELA
AVLESLTFDDVPAKKAWPVHPLGFGGRTPDEAFKEEEPPRVSWPAAVPAKSGAESPRVAE
EPRAQSLGPGPEVGGSDGDLSPPGRSDILEVKVAGGAPKSEPEIKFICTECGVSFPQLAR
LEAHQLRSHPGSRSFLCLCCGKSFGRSSILKLHMRTHTDERPHTCHLCGHGFRQSSHLSK
HLQTHSSEPAFLCAECGQGFQRRASLMQHLLAHAQDQKPPCASDPKTQAPPELSVVLCSH
CGQTFQRRSSLKRHLRIHAKDKGHQCSECSGSLRPAPERRPYVCGDCGKAFRRSEHLGAH
RRVHTGERPFSCQVCSRSFSQSSQLVSHQRVHTGEKPYSCPHCGKCFMRRAGLARHLLTH
GGPRPHHCAQCGKSFSQTQDLARHRRSHTGEKPCRCSECGEGFSQSAHLARHQRIHTGEK
PHVCDTCGHRFRNSSNLARHRRSHTGERPYGCQKCGRSFRRNAHLQRHLATHAGPGEEAG
SGQAEPPQECPECGKTFSRSCNLLRHMLVHTGARPYSCTQCGRSFSRNSHLLRHLRTHAR
ETLY
Download sequence
Identical sequences ENSSSCP00000027214 ENSSSCP00000021820 XP_003354694.2.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]