SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027304 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027304
Domain Number 1 Region: 2-74
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000000432
Family SEA domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027304   Gene: ENSSSCG00000026026   Transcript: ENSSSCT00000024198
Sequence length 78
Comment pep:novel chromosome:Sscrofa10.2:8:70288645:70291175:-1 gene:ENSSSCG00000026026 transcript:ENSSSCT00000024198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFQSSSIYRQYINSQVITLVPNDNSVTAHIWLVFKAHRSVKEDTRRRIENILRQMLRNHS
GSLTTDPDSLRLHGKLMY
Download sequence
Identical sequences ENSSSCP00000027304 ENSSSCP00000027304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]