SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027422 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027422
Domain Number 1 Region: 317-353
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000278
Family TRASH domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027422   Gene: ENSSSCG00000021814   Transcript: ENSSSCT00000028293
Sequence length 1138
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL895413.1:777:53771:-1 gene:ENSSSCG00000021814 transcript:ENSSSCT00000028293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVSPAGGLDLTDQTSVLLGSTAMAASLTNVGNSFSGPPAPLVARANKFQNSSVEDDDDV
VFIEPVQPPPPPAPVVTDQRTITFASSKNEELQGNDSKILPSAKELTSQKGSVSETIVID
DEEDMETNQGQEKNASSFIERRPPETKNRTSDVDFSTPSFSRSKVNAGVGNSGITTEPDS
EIQIADVTTLETGVSSVSDGQLESTDGQDMNLMITHVTSLQNTNLGEVANGLQSSNFGVN
IQTFTPSLTSQTKAAVGPFNPGRMNGAGDVFQNGESATHHNPDSWISQSASFPRNQKQPG
VDSLSPVASLPKQIFQPSAQQQPTKPVKVTCANCKKPLQKDLFCSTSCLSSFSHKPAPKK
LCVMCKKDITTMKGTIVAQVDSSESFQEFCSTSCLSLYEDKQNPTKGALNKSRCTICGKL
TEIRHEVSFKNMTHKLCSDHCFNRYRMANGLIMNCCEQCGEYLPSKGAGNNVLVIDGQQK
RFCCQSCVSEYKQVGSHPSFLKEVRDHVQDPFLTQPEKYGKLTACTGCRTQCRFFDMTQC
IGPNGYMEPYCSTACMNSHKTKYAKSPGLGIICHFCKRNSLPQYQATMPDGKLYNFCNSS
CVAKFQALSVQSSPNGQFVAPSDIQLKCNYCKNSFCSKPEVLEWENKVHQFCSKTCSDDY
KKLHCIVTYCEYCQEEKTLHETVNFSGVKRPFCSEGCKLLYKQDFARRLGLRCVTCNYCS
QLCKKGAAKEDGVGRDFCSEDCCRRFQDWYYKAARCDCCKSQGTLRERVQWRGEMKHFCD
QHXFYCQQNEPNMTTQKGPENLHYDQGCQTSRTKTTGSAPPPSPTPGKEMKNKAVLCKPL
TMTKATYCKPHMQSKSCQTDEGWRPERVPVPIPVPVYIPVPMHMYSQSVPVPTTVPVPVP
VPXPVFLPAPLDSSERIPAVVEELLKKKWKGYTLQSCFIISACVLSLQRGKAKTCRVNSL
MMETDLTASDLLKTSDPEAQPGMPDVPYEPDLDIEIDFPRAAEELDMENEFLLPPVFGEE
YEEQPRPRSKKKGAKRKALSGYQSHDDSSDNSECSFPFKYSYGVNAWKHWVRTRQLEELL
VLDELKSPKSVKLKEDLLCHSSAELNCGLAHFVREVRRPNGESYAPDSVYYLCLGIQE
Download sequence
Identical sequences ENSSSCP00000027422 ENSSSCP00000027422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]