SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027521 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000027521
Domain Number - Region: 63-103
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00164
Family Erythroid transcription factor GATA-1 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027521   Gene: ENSSSCG00000027800   Transcript: ENSSSCT00000024310
Sequence length 203
Comment pep:novel chromosome:Sscrofa10.2:3:103872581:103885823:-1 gene:ENSSSCG00000027800 transcript:ENSSSCT00000024310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKTTDRYVQQKRLKAAEAESKLKQVYIPTYKPNPNQISTSNGKPGAVNGAVGTTFQPQN
PLLGRACESCYATQSHQWYSWGPPNMQCRLCATCWLYWKKYGGLKMPTQSEEEKLSPSPT
TEDPRVRSHMSRQAMQGMPVRNTGSPKSAVKTRQAFFLHTTYFTKFARQVCKNTLRLRQA
ARRPFVPINYAAIRAECKMLLNS
Download sequence
Identical sequences ENSSSCP00000027521 ENSSSCP00000027521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]