SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027530 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027530
Domain Number 1 Region: 16-194
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-58
Family SPRY domain 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027530   Gene: ENSSSCG00000030126   Transcript: ENSSSCT00000029786
Sequence length 197
Comment pep:known chromosome:Sscrofa10.2:7:28808062:28813642:-1 gene:ENSSSCG00000030126 transcript:ENSSSCT00000029786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHYDEGNSIIQRYDWRKEEFKAVNVILDAATAHPALLLSKNGRRVTWKGTGQDLPRSTQR
FNSIPYVLGHLSICSGKSHWEVEVGNASCWDLGICRDNVTKKEEFTMSPQKGFWVIRLCD
GDYWALTSSVTLLTLKEKPLKVGIFLDYEAGYVSFYNMTDGSHIFSFSQNKFSGVLKPFF
RLWSSDSGFLTICPGEE
Download sequence
Identical sequences ENSSSCP00000027530 ENSSSCP00000027530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]