SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027620 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027620
Domain Number 1 Region: 84-381
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.16e-60
Family Nuclear receptor ligand-binding domain 0.0000251
Further Details:      
 
Domain Number 2 Region: 13-99
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.99e-29
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027620   Gene: ENSSSCG00000004384   Transcript: ENSSSCT00000022342
Sequence length 385
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:83541307:83562994:1 gene:ENSSSCG00000004384 transcript:ENSSSCT00000022342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGGC
PVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENGAAAHF
PSAALPAPAFFTAVTQLEPHGLELAAVSATPERQTLVSLAQPTPKYPHEVNGTPMYLYEV
ATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDAN
TLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTH
SGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEE
VFFKKTIGNVPITRLLSDMYKSSDI
Download sequence
Identical sequences B3RF24 F1PD89 F7AUI6 I3LU21 M3YEH4
ENSECAP00000016686 ENSCAFP00000005604 ENSSSCP00000027620 XP_001502073.2.31192 XP_003353327.1.46622 XP_004397964.1.74151 XP_004422241.1.5094 XP_004605763.1.94378 XP_004753512.1.14098 XP_006729521.1.47382 XP_007119117.1.24612 XP_014694529.1.49734 XP_019298569.1.44245 XP_021549171.1.83697 XP_532253.2.84170 9796.ENSECAP00000016686 9823.ENSSSCP00000004732 ENSECAP00000016686 ENSMPUP00000009731 ENSMPUP00000009731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]