SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027703 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027703
Domain Number 1 Region: 406-492
Classification Level Classification E-value
Superfamily DEATH domain 2.18e-19
Family DEATH domain, DD 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027703   Gene: ENSSSCG00000027922   Transcript: ENSSSCT00000027240
Sequence length 520
Comment pep:known chromosome:Sscrofa10.2:7:41631101:41640482:-1 gene:ENSSSCG00000027922 transcript:ENSSSCT00000027240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCAHESSFQPAQFLLXGFPVASAVPLVQCLRWRCPSGGLLGALLEAGEARGNRHPSIPLP
LPKNESPWQGPPATLQEMVSFYRSCTRPPKGQTIIRQLMHKLLMFSAREVDHRGGCLMLQ
DAGISLLIPPGAVSVGRQERVSLVLVWDLSDAPSLSRAQGLVSPVVACGPHGASFLKPCT
LTFKHCAQQPSHARTYSSNTTLLDAKAWKPLGRRGDHTSRDECRIQLSHFSLYTCVLEAP
AGQEARKWLQLAVFCSPLAPGQTHLQLRVYFLNNTPCALQWAVTNEQPHGGRLRGPCQLF
DFTGARGDQCLKLKYISEGWENVDDSSCQLVPHLHIWHGKCPFRSFCFRRKAANENEDCS
ALTNEIIVTMHTFQDGLETKYMEILRFQASEEESWAAPPPVTQPPPCNRLPPELFERLQM
LLEPNSITGNDWRRLASHLGLCGMKIRFLSCQRSPAAAILELFEEQNGSLQELHYLMTIM
ERLDCASVIQNYLNGTQSGSPALVRGGAQENQALELDEKL
Download sequence
Identical sequences ENSSSCP00000027703 ENSSSCP00000027703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]