SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027871 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027871
Domain Number 1 Region: 6-90
Classification Level Classification E-value
Superfamily DEATH domain 2.39e-26
Family DEATH domain, DD 0.0000516
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027871   Gene: ENSSSCG00000024470   Transcript: ENSSSCT00000028593
Sequence length 96
Comment pep:known_by_projection scaffold:Sscrofa10.2:JH118967.1:6938:16651:1 gene:ENSSSCG00000024470 transcript:ENSSSCT00000028593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGPSAFSIPPPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDL
WEAQNFPDGNLSVLAAVLEEMGRHETVVSLATEGQY
Download sequence
Identical sequences ENSSSCP00000027871 ENSSSCP00000027871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]