SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027909 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000027909
Domain Number - Region: 5-52
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0745
Family SMI1/KNR4-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027909   Gene: ENSSSCG00000022072   Transcript: ENSSSCT00000026489
Sequence length 110
Comment pep:novel chromosome:Sscrofa10.2:17:40765948:40772471:-1 gene:ENSSSCG00000022072 transcript:ENSSSCT00000026489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAPEGCSLPPHYNCCLSSKQDWFPWSLLLLSLTCDTGAFYVPGVAPINFHQNDPVEIKAV
KLTSSRTQLPYEYYSLPFCQPSKITYKAENLGKAFSHTAVLLSPRGTQIF
Download sequence
Identical sequences ENSSSCP00000027909 ENSSSCP00000027909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]