SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028034 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028034
Domain Number 1 Region: 93-183
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.22e-31
Family POU-specific domain 0.0000206
Further Details:      
 
Domain Number 2 Region: 223-317
Classification Level Classification E-value
Superfamily Homeodomain-like 5.77e-26
Family Homeodomain 0.00000865
Further Details:      
 
Domain Number 3 Region: 1-32
Classification Level Classification E-value
Superfamily Dimerization cofactor of HNF-1 alpha 0.000000000419
Family Dimerization cofactor of HNF-1 alpha 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028034   Gene: ENSSSCG00000022417   Transcript: ENSSSCT00000023424
Sequence length 347
Comment pep:known chromosome:Sscrofa10.2:12:40788316:40846408:-1 gene:ENSSSCG00000022417 transcript:ENSSSCT00000023424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSKLTSLQQELLSALLSSGVTKEVLVQALEELLPSPSFGVKLETLPLSPGSGTEPDTKP
VFHTLTNGHAKGRLSGDEGEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRA
AKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILR
QFNQTVQSSGNLTDKSSQDQLLFLFPEFSQQSQGPGQSDDACSEPTNKKMRRNRFKWGPA
SQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFA
NRRKEEAFRQKLAMDAYSSNQTHSLNTLLSHSSPHHQPSTSPPNKLP
Download sequence
Identical sequences ENSSSCP00000028034 ENSSSCP00000028034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]