SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028058 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028058
Domain Number 1 Region: 50-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.56e-34
Family SCAN domain 0.00013
Further Details:      
 
Domain Number 2 Region: 219-277
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.72e-21
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 466-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.49e-18
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 4 Region: 738-790
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.56e-18
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 806-858
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.13e-16
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 944-996
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 563-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000838
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 8 Region: 630-686
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000108
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 9 Region: 845-898
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000314
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 10 Region: 503-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000261
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028058   Gene: ENSSSCG00000024556   Transcript: ENSSSCT00000026394
Sequence length 999
Comment pep:novel chromosome:Sscrofa10.2:13:30608378:30617562:1 gene:ENSSSCG00000024556 transcript:ENSSSCT00000026394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGRWYAVHPAQAKASRERGRLQMVKKEEEDEDYTSVPATRPQTLNRPGQELFRQLFRQ
LRYHESSGPLETLSRLRELCRWWLRPDVLSKAQILELLVLEQFLSILPGELRTWVQLHHP
ESGGEAVALLEELQRDFDGSPWRDPAPAQSPDVHWMGTGALQATQIWPPASPLRSGSALG
DHLQPPCEIGVRDFLAGQPDSPAAQVPTLSQREGCPGDQEALTFKDVEVTFSQDEWGWLD
ASQRNLYRDVMLENYGNIASLMGPFTKPALISWLETREPWVLNVQGAQPEGNPGADVAVS
GGELHMKTKKFNLKHEPLKEAVTLAIPSGCHGSANISKETGLREPSEQKSRLKEPCGNPV
QVKVEKEETDSSHGTGKDCEDSGRSNSLHLKHTMYLRGPRRKQSLKHGCGRHFRGSSYHC
EYKEYGKGLRCLLGGFSLHQRIHAGLKGKPKDAHGKDFSLSSHHQHAQNRHVRLHTQEKP
FKCRACGKAFRWSSNRARHEKIHTGLKPYKCNLCDKAFRRMSAYRLHQETHAKQKCLESN
QYEEALSCGSEFERHLGDQTGEKLFDCSQCRKSFHCKSYILEHQRIHTQEKPYKCTKCRK
TFRWRSNFTRHMRLHQEETFYDQDECREDFRQTPNDSQPQRAPTVENSFSCQQCGKTFTQ
KKSLIDHQRSHSGEKSYWCSECAKEFTHRSTFVVHKKQHTFKREPEDAPPLSQDRAFQVP
QSSHTTEEPCTCSQCGRAFRNHSILLIHQRVHTREKPYKCMECGKSFRWSSNLSQHQRVH
SLEKPYMYREREDPPNLQSQILTGEKPFWCQECGKTFTRKRSLIDHKGIHSGEKRYKCNL
CGKSYDRNHRLVNHQRIHTKERPFKCQWCGKDFIGRHTLCVHQRKHTSVAQSECSVAGLS
SRQDSRVSLQELKPREEKPLEDCKEACDQRSGLTGLEDVPIGGKCHKCSTCGKTFNKSSQ
LISHKRFHTRERPFKCRECGKTFRWSSNLARHMKSHVRD
Download sequence
Identical sequences ENSSSCP00000028058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]