SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028209 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028209
Domain Number 1 Region: 66-142
Classification Level Classification E-value
Superfamily Translation proteins 5.3e-18
Family Gar1-like SnoRNP 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028209   Gene: ENSSSCG00000020907   Transcript: ENSSSCT00000022770
Sequence length 210
Comment pep:known chromosome:Sscrofa10.2:8:120483790:120496430:-1 gene:ENSSSCG00000020907 transcript:ENSSSCT00000022770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFRGGGRGGFNRGGGFGRGGSGNNHFRGGGGGNFRGGGGRGGFGRGGGRGGFNKGQDQG
PPEQVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYF
SVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGRGGGGR
GGRGGGFRGGRGGGGFRGGRGGGGFRGRGH
Download sequence
Identical sequences 9823.ENSSSCP00000009743 ENSSSCP00000028209 XP_003129300.1.46622 XP_003129301.1.46622 XP_005656602.1.46622 ENSSSCP00000028209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]