SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028258 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028258
Domain Number 1 Region: 283-323
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000015
Family LIM domain 0.00049
Further Details:      
 
Domain Number 2 Region: 249-282
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000149
Family LIM domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028258   Gene: ENSSSCG00000015917   Transcript: ENSSSCT00000033678
Sequence length 786
Comment pep:novel chromosome:Sscrofa10.2:15:82491704:82597615:1 gene:ENSSSCG00000015917 transcript:ENSSSCT00000033678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERSLCSPTFKSHPGSQSDDSVKDSDKKGKETSFDKMSPERGHRHIFEGTAGPNKPASGF
AEASVSDLQEVVSLKERMARYQAAVTRGDCRSFSANMMEESETCTLPGGLARVKKQFEKD
KTASSCNTFSQYQYQHQNRSEQEVIRSSQVDISRSSQEMERNEQEISKAQKTDVLGTEMA
SHLEKHSKEINQASRLHQYVQETVIDTPKDEEIPKVSTKFLKEQFEKSAQEKVLYSDKEM
TPAKQIKKLQHQDKETCILCQKTVYPMECLVADRQSFHKSCFRCHHCNSKLSLGNYASLH
GQIYCKPHFKQLFKSKGNYDEGFGHKQHKDRWNCKKQSSSVDFTPNEKPNMCKNSAENTP
LLGELNTHLDAGNSEGQRDDLRKCGERGKLNIIWPPSKEMPKKTFPLEEELKMCKPKWPP
EMTTLTSAEFESESLIDHLKTVENKGQEQDNTSFLQPYLQPIHLSQKEDVTGIKEVEMYE
ARKDEKKEGNKNVQDKLNETEDTKSKRKSEMDLNDNNNVQSAEKGKNEKTNEPDGADVLQ
VPNTDDEVVAEDHKENLNKNNNNNYVAVSYLNNCRQKTSILEFPLSSEAHYTANEYQIET
LENASRISELLGIFESEKTYSSNVLAMALEEQTDRATAGSPVQSVPKPGLSGGIIEKGKS
AMPSSDTNTLNIKGNHSNNKNLHFLFSNTVKIAAFSKKNEKIFEPNLIGSVEQIKTMPCY
LRELGKGVRHWHGETLGAAHTNGNQSADAPRSEFTTKSPFPRVDVQSEQLTVEEQIKRNR
CYSDTE
Download sequence
Identical sequences ENSSSCP00000028258 ENSSSCP00000028258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]