SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028277 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028277
Domain Number 1 Region: 139-383
Classification Level Classification E-value
Superfamily Caspase-like 2.99e-57
Family Caspase catalytic domain 0.00018
Further Details:      
 
Domain Number 2 Region: 1-87
Classification Level Classification E-value
Superfamily DEATH domain 4.83e-21
Family DEATH effector domain, DED 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028277   Gene: ENSSSCG00000016101   Transcript: ENSSSCT00000036156
Sequence length 386
Comment pep:known chromosome:Sscrofa10.2:15:116156431:116184641:1 gene:ENSSSCG00000016101 transcript:ENSSSCT00000036156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEIGEGLDKSDVSSLIFLMRDHISRSKMAKDKSFLDLVIELEKLNLVAPDHLDLLEKCL
RNIHRIDLKTKIQKYKQSAQGAETNYVNALQASLPNLSIKDPSYNLRLQNGRSKEQSLIL
GHPDFQRDPVKTSIQESGAFLLQHVPEERYKMQSKPLGICLIIDCVGNDTDVLRDTFSSL
GYEVQYFLYLKVEQISKILRKVARMPQHQDYDSFVCVLVSRGGSQSVFGVDKTLSGFPLD
HIRRMFMADVCPTLLGKPKLFFIQIYVTSEGQLEDSSFLEVDGPSVKSMDSKARQPGTCT
VHREADFFWSLCKADVSLLERPSSSSSVYLQCLSQKLGKERKVSLLELHVDLNSKVYDWN
SRVSAKERYYVRLQHTLRKKVILSCK
Download sequence
Identical sequences ENSSSCP00000028277 XP_005652502.1.46622 XP_005652503.1.46622 XP_005652504.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]