SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028574 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028574
Domain Number 1 Region: 132-378
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.93e-63
Family Nuclear receptor ligand-binding domain 0.000000000427
Further Details:      
 
Domain Number 2 Region: 20-102
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-27
Family Nuclear receptor 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028574   Gene: ENSSSCG00000014401   Transcript: ENSSSCT00000036693
Sequence length 379
Comment pep:known chromosome:Sscrofa10.2:2:151054873:151085617:-1 gene:ENSSSCG00000014401 transcript:ENSSSCT00000036693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPDVSSPPSSSSAATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCA
GRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENSANK
TIVPATLPQLTPTLVSLLEVIEPEVLYAGYDSSIPDSTWRIMTALNMLGGRQVIAAVKWA
KAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSASLLCFAPDLVINEQRMALPC
MYDQCRHMLYVSSELQRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELG
KAIVKREGNSSQNWQRFYQLTKLLDSMHDVVENLLNYCFQTFLDKNMSIEFPEMLAEIIT
NQLPKYSSGNIKKLLFHQK
Download sequence
Identical sequences ENSSSCP00000028574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]