SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028599 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028599
Domain Number 1 Region: 89-172
Classification Level Classification E-value
Superfamily DEATH domain 2.83e-18
Family Caspase recruitment domain, CARD 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028599   Gene: ENSSSCG00000024096   Transcript: ENSSSCT00000034284
Sequence length 187
Comment pep:known chromosome:Sscrofa10.2:4:51491691:51494456:-1 gene:ENSSSCG00000024096 transcript:ENSSSCT00000034284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSSQLHKPSNSPGTSKSLSATQDSDFLSRKTQDFSTPRQCPVNRSWDSNISVAQRATFCD
HKTTPCSLAIINPLSAEGNSERFQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDL
IMKEDYELISTKPTRTSKVRQLLDTTDIQGEEFARVIVQKLKDNKQMGLQPYPEILVVSR
PPSLNLF
Download sequence
Identical sequences ENSSSCP00000028599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]