SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028707 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028707
Domain Number 1 Region: 26-81
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000405
Family TNF receptor-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028707   Gene: ENSSSCG00000000705   Transcript: ENSSSCT00000034359
Sequence length 119
Comment pep:known chromosome:Sscrofa10.2:5:66659869:66663924:-1 gene:ENSSSCG00000000705 transcript:ENSSSCT00000034359 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MARSPLCWLWVLGTLAGLSATPAPQSCPEKHYWARGELCCQMCQPGTFLVKDCDQHGKAA
RCDPCKQGVSFSPDYHSRPHCESCRHCNSGPTGRPFPDPEPVCTPLPVLQTSLSHGPSL
Download sequence
Identical sequences ENSSSCP00000028707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]